PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009620130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 258aa    MW: 28770.1 Da    PI: 8.7829
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009620130.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.76.2e-194085147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd++l ++v+++G ++W++I++++  gR++k+c++rw + 
   XP_009620130.1 40 KGPWSAEEDKILTKLVERYGARNWSLISKYIK-GRSGKSCRLRWCNQ 85
                     79*****************************9.***********985 PP

2Myb_DNA-binding55.41.4e-1794136347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++++ Ede ++ a++++G++ W+tIar ++ gRt++ +k++w++ 
   XP_009620130.1  94 PFSQTEDETILAAHAKYGNR-WATIARLLP-GRTDNAVKNHWNST 136
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.8163590IPR017930Myb domain
SuperFamilySSF466892.26E-3138133IPR009057Homeodomain-like
SMARTSM007171.1E-163988IPR001005SANT/Myb domain
PfamPF002492.5E-184085IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-254193IPR009057Homeodomain-like
CDDcd001671.13E-154284No hitNo description
PROSITE profilePS5129421.41791141IPR017930Myb domain
SMARTSM007172.6E-1591139IPR001005SANT/Myb domain
CDDcd001673.77E-1294137No hitNo description
Gene3DG3DSA:1.10.10.602.9E-2394140IPR009057Homeodomain-like
PfamPF002491.4E-1494136IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MEFFNRCSTS TTSSSCESSS SESSLSGKTP RDGKKSERIK GPWSAEEDKI LTKLVERYGA  60
RNWSLISKYI KGRSGKSCRL RWCNQLSPNV QHRPFSQTED ETILAAHAKY GNRWATIARL  120
LPGRTDNAVK NHWNSTLKRR YQQLLQQQNQ SPVVYSDVKI NGSASGSGPC MDYMNANESP  180
IRGNFPINNV VTTNCSSEFD DPMTTLSLAP PGMGGDELPE RKTESFPAEF WDVMRDVIAK  240
EVREYVASSF SGASTGFP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-41371401104MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009620130.10.0PREDICTED: transcription factor MYB44-like
RefseqXP_016433235.10.0PREDICTED: transcription factor MYB44-like
TrEMBLM1ADU41e-122M1ADU4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000206351e-121(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA79502131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.14e-57myb domain protein 73